A practical reference on lyophilisation: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-10-07 and is reviewed periodically as new material appears.
Semaglutide is a synthetic peptide analog of human glucagon-like peptide-1, developed by Novo Nordisk and first approved in 2017 for type 2 diabetes. It belongs to the incretin mimetic class, a group of agents that reproduce the glucose-dependent actions of endogenous GLP-1. The molecule was engineered to resist degradation by dipeptidyl peptidase-4 and to bind serum albumin, extending its half-life from minutes to roughly one week. Approval for chronic weight management followed in 2021, based on large cardiovascular and obesity outcome trials.
GLP-1 receptors are expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises cyclic AMP, enhances glucose-dependent insulin secretion, and suppresses glucagon release when blood glucose is high. Effects on gastric emptying and on hypothalamic appetite circuits reduce energy intake. Because insulin release remains glucose-dependent, the risk of hypoglycemia is low when the drug is used alone. The precise contribution of each pathway to body weight change in humans remains an area of active investigation.
Clinical studies of semaglutide generally measure glycated hemoglobin, fasting plasma glucose, body weight, and composite cardiovascular endpoints. The SUSTAIN program enrolled adults with type 2 diabetes, while the STEP program focused on obesity without diabetes. Administration follows a stepwise escalation schedule designed to limit gastrointestinal effects during the first weeks. Reported outcomes include mean percentage weight change, the proportion of participants reaching defined weight-loss thresholds, and rates of nausea, vomiting, and diarrhea. Long-term data on durability after treatment stops are still limited and remain a topic of ongoing research.
The primary target is the GLP-1 receptor, a class B G protein-coupled receptor expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises intracellular cyclic AMP, which potentiates glucose-dependent insulin secretion and lowers glucagon release when blood glucose is elevated. Signalling in the hypothalamus and brainstem is associated with reduced appetite and slower gastric emptying. Because the insulinotropic effect depends on prevailing glucose levels, the hypoglycaemic risk of the peptide alone is described as low in most study settings. The relative contribution of peripheral and central actions remains an active research question.
Large randomised trials in adults with type 2 diabetes and in adults with obesity have reported reductions in body weight and improvements in several cardiovascular risk markers. One outcome trial found a lower incidence of major adverse cardiovascular events in participants with diabetes and established cardiovascular disease. Gastrointestinal effects such as nausea and vomiting are the most frequently reported adverse events and often diminish over time. Changes in lean body mass during weight loss are an area of ongoing investigation. Effects in adolescents and in pregnancy are less well characterised, and current labelling advises against use during pregnancy.
Semaglutide is a synthetic peptide analogue of glucagon-like peptide-1, a gut hormone released after nutrient intake. The molecule contains 31 amino acid residues and differs from the native sequence at several positions. A non-natural residue at position eight resists the enzyme that normally truncates the hormone, while a lysine-linked fatty diacid side chain promotes binding to serum albumin. These two modifications extend the circulating half-life from minutes to roughly one week. The peptide is produced by solid-phase synthesis followed by selective acylation, and its identity and purity are confirmed by spectrometric and chromatographic techniques.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C187H291N45O59 | Peptide backbone with a C18 fatty diacid side chain |
| Molecular weight | Approximately 4113 Da | Consistent with a 31-residue peptide plus linker |
| Appearance | White to off-white powder | Lyophilized solid; hygroscopic if left open |
| Solubility class | Sparingly soluble to soluble in water | Varies with pH and ionic strength |
| Typical analytical method | Reversed-phase HPLC with UV detection | Often paired with mass spectrometry for identity |
Quality control for peptide material focuses on identity, purity, content and the profile of impurities. Common degradants include deamidated and oxidised forms, plus aggregates formed during storage or handling. Forced degradation studies under heat, light, acid and peroxide help define which conditions accelerate change and which analytical methods detect it. Limits for individual impurities are set by pharmacopoeial monographs or manufacturer specifications. How much a given impurity affects biological activity is often uncertain, and conclusions may depend on the assay used.
Solid peptide material is generally kept at reduced temperature to limit degradation. Short-term storage at 2 to 8 degrees Celsius is common, while longer archival storage at minus 20 degrees Celsius or below is typical for lyophilised powder. Vials should remain sealed and protected from light, because ultraviolet exposure can oxidise susceptible residues. Repeated freeze-thaw cycles are avoided, as they promote aggregation and loss of soluble material. Solutions are less stable than solids and are usually prepared close to the time of use.
Reversed-phase high-performance liquid chromatography is widely used to assess purity and to separate the parent peptide from related substances. Mass spectrometry confirms identity and can resolve modifications that differ by a few daltons. Size-exclusion chromatography detects dimers and higher aggregates, which are relevant to both stability and immunogenicity questions. Peptide mapping with enzymatic digestion locates specific modifications along the sequence. Circular dichroism provides a secondary-structure profile, although it gives limited information about local conformational changes.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 or 280 nanometres is widely used to assess purity and to resolve related impurities. Liquid chromatography coupled to mass spectrometry confirms identity through the protonated molecular ion and fragment ions formed in tandem experiments. Capillary electrophoresis and peptide mapping after enzymatic digestion supply complementary information on charge variants and modification sites. Circular dichroism and nuclear magnetic resonance can report on secondary structure in solution. Absolute quantification usually depends on an external standard, and reported purity depends on the detection wavelength and integration parameters chosen.
Lyophilised material appears as a white to off-white cake or powder that is hygroscopic, and containers are usually equilibrated to room temperature before opening to limit condensation. Dissolution is performed in water, phosphate-buffered saline, or a mildly alkaline buffer, since solubility rises above neutral pH. Gentle inversion or low-speed mixing is preferred, because vigorous vortexing can promote surface denaturation and aggregation. Complete dissolution may require several minutes, and brief sonication is sometimes applied. Passing the solution through a 0.22 micrometre membrane removes particulates but does not by itself sterilise the liquid.
Enhanced mobility – components are described as "familiar, performance-enhancing, eat-out-of-hand" foods that require little or no preparation by the soldier. The beverages are reconstituted (CamelBak compatible) and consumed right out of the pouch. No water is needed for food preparation, only for the beverage mix. The food takes the form of pocket sandwiches to be eaten by hand. Lightweight – when compared to three Meals, Ready-to-Eat, the FSR reduces the weight and volume of one day's subsistence by approximately 50%. Characteristics – has a minimum two-year shelf life at 80 °F (27 °C) and provides an average of 2,900 calories per day. The FSR has nine meals per shipping container consisting of three each of three different menus up through 2010. Since 2011 there are 9 different meal combinations per shipping container. Meals – Each pouch contains items for a breakfast, lunch, and a dinner, although there is no requirement to consume the items in any specific order.
== Properties == Like some other aldehydes, phenylglyoxal polymerizes upon standing, as indicated by solidification of the liquid. Upon heating, this polymer "cracks" to give back the yellow aldehyde. Dissolution of phenylglyoxal in water gives crystals of the hydrate:
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
diphtheriae infection (Barcoo rot, diphtheric desert sore, septic sore, Veldt sore) Cutaneous group B streptococcal infection Cutaneous Pasteurella hemolytica infection Cutaneous Streptococcus iniae infection Dermatitis gangrenosa (gangrene of the skin) Ecthyma Ecthyma gangrenosum Ehrlichiosis ewingii infection Elephantiasis nostras Endemic typhus (murine typhus) Epidemic typhus (epidemic louse-borne typhus) Erysipelas (ignis sacer, Saint Anthony's fire) Erysipeloid of Rosenbach Erythema marginatum Erythrasma External otitis (otitis externa, swimmer's ear) Felon Flea-borne spotted fever Flinders Island spotted fever Flying squirrel typhus Folliculitis Fournier gangrene (Fournier gangrene of the penis or scrotum) Furunculosis (boil) Gas gangrene (clostridial myonecrosis, myonecrosis) Glanders (equinia, farcy, malleus) Gonococcemia (arthritis–dermatosis syndrome, disseminated gonococcal infection) Gonorrhea (clap) Gram-negative folliculitis Gram-negative toe web infection Granuloma inguinale (Donovanosis, granuloma genitoinguinale, granuloma inguinale tropicum, granuloma venereum, granuloma venereum genitoinguinale, lupoid form of groin ulceration, serpiginous ulceration of the groin, ulcerating granuloma of the pudendum, ulcerating sclerosing granuloma) Green nail syndrome Group JK Corynebacterium sepsis Haemophilus influenzae cellulitis Helicobacter cellulitis Hospital furunculosis Hot tub folliculitis (Pseudomonas aeruginosa folliculitis) Human granulocytotropic anaplasmosis Human monocytotropic ehrlichiosis Impetigo contagiosa Japanese spotted fever Leptospirosis (Fort Bragg fever, pretibial fever, Weil's disease) Listeriosis Ludwig's angina Lupoid sycosis Lyme disease (Afzelius' disease, Lyme borreliosis) Lymphogranuloma venereum (climatic bubo, Durand–Nicolas–Favre disease, lymphogranuloma inguinale, poradenitis inguinale, strumous bubo) Malakoplakia (malacoplakia) Mediterranean spotted fever (Boutonneuse fever) Melioidosis (Whitmore's disease) Meningococcemia Missouri Lyme disease Mycoplasma infection Necrotizing fasciitis (flesh-eating bacteria syndrome) Neonatal toxic shock-like exanthematous disease Nocardiosis Noma neonatorum North Asian tick typhus Ophthalmia neonatorum Oroya fever (Carrion's disease) Pasteurellosis Perianal cellulitis (perineal dermatitis, streptococcal perianal disease) Periapical abscess Pinta Pitted keratolysis (keratolysis plantare sulcatum, keratoma plantare sulcatum, ringed keratolysis) Plague Primary gonococcal dermatitis Pseudomonal pyoderma Pseudomonas hot-foot syndrome Pyogenic paronychia Pyomyositis Q fever Queensland tick typhus Rat-bite fever Recurrent toxin-mediated perineal erythema Rhinoscleroma Rickettsia aeschlimannii infection Rickettsialpox Rocky Mountain spotted fever Saber shin (anterior tibial bowing) Saddle nose Salmonellosis Scarlet fever Scrub typhus (Tsutsugamushi fever) Shigellosis Staphylococcal scalded skin syndrome (pemphigus neonatorum, Ritter's disease) Streptococcal intertrigo Superficial pustular folliculitis (impetigo of Bockhart, superficial folliculitis) Sycosis vulgaris (barber's itch, sycosis barbae) Syphilid Syphilis (lues) Tick-borne lymphadenopathy Toxic shock syndrome (streptococcal toxic shock syndrome, streptococcal toxic shock-like syndrome, toxic streptococcal syndrome) Trench fever (five-day fever, quintan fever, urban trench fever) Tropical ulcer (Aden ulcer, jungle rot, Malabar ulcer, tropical phagedena) Tularemia (deer fly fever, Ohara's disease, Pahvant Valley plague, rabbit fever) Verruga peruana Vibrio vulnificus infection Yaws (bouba, frambösie, parangi, pian)
Sources: en.wikipedia.org
Category:Liberal Party (UK) MPs List of Liberal Party (UK) MPs Liberalism in the United Kingdom Liberal Democrats Leader of the Liberal Party (UK) List of United Kingdom Whig and allied party leaders, 1801–1859 Liberal Chief Whip President of the Liberal Party List of Liberal Party and Liberal Democrats (UK) general election manifestos
external causes: these include the Six Excesses and "Pestilential Qi". internal causes: the "Seven Affects" (七情; qī qíng, sometimes also translated as "Seven Emotions") – joy, anger, brooding, sorrow, fear, fright and grief. These are believed to be able to cause damage to the functions of the zàng-fú, especially of the Liver. non-external-non-internal causes: dietary irregularities (especially: too much raw, cold, spicy, fatty or sweet food; voracious eating; too much alcohol), fatigue, sexual intemperance, trauma, and parasites (虫; chóng).
Scholars associate the Roman, Hellenic, and Christian imperial identities with the general population, but there is ongoing debate about how these and other regional identities blended together. As many as 27 million people lived in the empire at its peak in 540, but this fell to 12 million by 800. Although plague and territorial losses to Arab Muslim invaders weakened the empire, it eventually recovered and by the near end of the Macedonian dynasty in 1025, the population is estimated to have been as high as 18 million. A few decades after the recapture of Constantinople in 1282, the empire's population was in the range of 3–5 million; by 1312, the number had dropped to 2 million. By the time the Ottoman Turks captured Constantinople, there were only 50,000 people in the city, one-tenth of its population in its prime. Slavery remained legal but declined in economic importance as many former slave roles became free professions and the state increasingly promoted intermediate forms of dependency such as the coloni. From the 4th century, imperial legislation progressively limited owners' powers and restricted the enslavement of children, prisoners of war, and eventually Christians.
=== Reconstructed set point === In healthy persons, the intra-individual variation of TSH and thyroid hormones is considerably smaller than the inter-individual variation. This results from a personal set point of thyroid homeostasis. In hypothyroidism, it is impossible to directly access the set point, but it can be reconstructed with methods of systems theory. A computerised algorithm, called Thyroid-SPOT, which is based on this mathematical theory, has been implemented in software applications. In patients undergoing thyroidectomy it could be demonstrated that this algorithm can be used to reconstruct the personal set point with sufficient precision.
Fentanyl's most common side effects, which affect more than 10% of people, include nausea, vomiting, constipation, dry mouth, somnolence, confusion, and asthenia (weakness). Less frequently, in 3–10% of people, fentanyl can cause abdominal pain, headache, fatigue, anorexia and weight loss, dizziness, nervousness, anxiety, depression, flu-like symptoms, dyspepsia (indigestion), shortness of breath, hypoventilation, apnea, and urinary retention. Fentanyl use has also been associated with aphasia. Despite being a more potent analgesic, fentanyl tends to induce less nausea, as well as less histamine-mediated itching, than morphine. In rare cases, serotonin syndrome is associated with fentanyl use. Existing studies advise medical practitioners to exercise caution when combining selective serotonin reuptake inhibitor (SSRI) drugs with fentanyl. The duration of action of fentanyl has sometimes been underestimated, leading to harm in a medical context. In 2006, the United States Food and Drug Administration (FDA) began investigating several respiratory deaths, but doctors in the United Kingdom were not warned of the risks with fentanyl until September 2008. The FDA reported in April 2012 that twelve young children had died and twelve more had become seriously ill from separate accidental exposures to fentanyl skin patches.
Sources: en.wikipedia.org
==== RNC-seq ==== The full length translating mRNA (RNC-seq) involves centrifugation of lysated sample on a sucrose cushion. This allows separation of the Ribosome-nascent chain complex(RNC) from free mRNA and other cell components. The RNCs form a pellet in the centrifugation that is collected for further analysis. The mRNA being translated in these RNCs can be sequenced, allowing identification and quantification of the mRNAs being translated at the time. However, RNC-mRNA complexes are fragile, which can lead to ribosomes to dissociate from the mRNAs and degradation of the mRNAs, potentially biasing the collected results.
=== Pharmacodynamics === para-Chlorophenethylamine acts primarily as a serotonin-releasing agent with an EC50Tooltip Half maximal effective concentration value of 430 nM for the serotonin transporter, approximately the dose required to induce serotonin syndrome with seizures, tremor, and hyperthermia in mice, is quite low compared to other derivatives (such as ortho-chlorophenethylamine and meta-chlorophenethylamine) In mice with serotonin syndrome induced by para-chlorophenethylamine, the following symptoms were observed: lateral head bobbing, a Straub tail reaction, abduction of the hind limbs, tremors, hyperactivity, mutual pawing with the front paws, salivation, and piloerection. It acts as a full, weak agonist of TAAR with an EC50 value of 2,900 ± 1,000 nM. In vitro, it inhibited the activity of the enzyme phenylethanolamine N-methyltransferase. Para-chlorophenelethylamine stimulated 5-HT receptors.
== Awards and recognition == Thomsen has been recognized for his contributions to pharmaceutical research and development. His work has supported advancements in drug discovery and innovation in medical science.
Provides straightforward information about effects arising from individual compounds in complex or natural samples separated in parallel. Combines chromatographic separation with effect-directed detection using enzymatic or biological assays. Helps to select important compounds from a sample for further characterization using high-resolution mass spectrometry. Offers unique benefits such as super-hyphenation, minimum sample preparation requirements, detection of multi-modulating compounds, and distinguishing agonistic versus antagonistic effects.
=== SSAP === The SSAP (Sequential Structure Alignment Program) method uses double dynamic programming to produce a structural alignment based on atom-to-atom vectors in structure space. Instead of the alpha carbons typically used in structural alignment, SSAP constructs its vectors from the beta carbons for all residues except glycine, a method which thus takes into account the rotameric state of each residue as well as its location along the backbone. SSAP works by first constructing a series of inter-residue distance vectors between each residue and its nearest non-contiguous neighbors on each protein. A series of matrices are then constructed containing the vector differences between neighbors for each pair of residues for which vectors were constructed. Dynamic programming applied to each resulting matrix determines a series of optimal local alignments which are then summed into a "summary" matrix to which dynamic programming is applied again to determine the overall structural alignment. SSAP originally produced only pairwise alignments but has since been extended to multiple alignments as well. It has been applied in an all-to-all fashion to produce a hierarchical fold classification scheme known as CATH (Class, Architecture, Topology, Homology), which has been used to construct the CATH Protein Structure Classification database.
Sources: en.wikipedia.org
It is given either as a once-weekly subcutaneous injection or as an oral tablet taken once daily. The two forms use different absorption strategies, so they are not interchangeable on a milligram-for-milligram basis.
Structural modifications, including a fatty acid side chain and non-natural amino acid substitutions, slow enzymatic breakdown and promote albumin binding. These changes support once-weekly dosing rather than twice-daily administration.
The pathways involving insulin, glucagon, gastric emptying, and appetite signaling are well described. How much each pathway contributes to weight reduction in a given person is not fully established.
Native GLP-1 is degraded within minutes by dipeptidyl peptidase-4 and neutral endopeptidases. Semaglutide carries a non-natural amino acid at position eight that blocks that cleavage, and a fatty diacid side chain that binds albumin. The result is a much longer duration of action than the native hormone.